[Uriengit]

Newsensations.com- Allyssa Hall - Screw My Girlfriend While I Watch





Description:

Allyssa Hall has decided to fulfill her boyfriends fantasy and let another man fuck her stupid while he watches. The surly chap arrives promptly and proceeds to cram his enormous cock deep within every available orifice. The boyfriend watches with wide eyes as the surrogate blows a mammoth load into her grinning grill.
Model:
Allyssa Hall, Tommy Gunn
Studio:
Newsensations.com
Info:
File Name : allyssa_hall_screwmygirlfriendwhileiwatch.mp4
File Size : 1923.06 MB
Resolution : 1280x720
Duration : 00:43:52
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:jb-allyssa_hall_SMGWIW_16x9.zip - 28.4 MB

Download VIDEO:
UbiqFile:allyssa_hall_screwmygirlfriendwhileiwatch .mp4 - 1.9 GB

[Uriengit]

Newsensations.com- Eden Adams - Keepin_ It Fresh 03





Description:

Sweet young babe Eden Adams is crazy for cock and when her man is not meeting her needs she gives us a call. We come right over and get to the fucking With her mouth full of our meat, Eden works in and out of her throat for one hell of a blow job. Eden really likes to be fucked hard and our meat gives her everything she wants. There_s nothing like a girl who enjoys a good pussy slam and a face full of sticky goo
Model:
Eden Adams, Jordan Ash
Studio:
Newsensations.com
Info:
File Name : eden_adams_jordan_ash_keepin-itfresh-03.mp4
File Size : 286.67 MB
Resolution : 1280x720
Duration : 00:24:27
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-eden_adams_jordan_ash_KeepinItFresh03_16x9.zip - 50.7 MB

Download VIDEO:
UbiqFile:eden_adams_jordan_ash_keepin-itfresh-03.mp4 - 286.7 MB

[Uriengit]

Newsensations.com- Maya Hills - She Only Takes Diesel 03





Description:

This tiny blonde is about to get her pussy wrecked. Maya Hills had heard the rumors and now is about to find out that they are true Maya wraps her lips around this giant black shaft, sucking and licking as her spit runs down her chin. Once we flip her over we have a clear shot at her tight twat. Cramming our cock deep inside, we drill her pink velvet tunnel leaving her tore up pussy gapping With her pussy sore and our cock chowder dripping from her chin, Maya goes home a happy girl
Model:
Maya Hills, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : maya_hills_shane_diesel_sheonlytakesdiesel03.mp4
File Size : 1254.53 MB
Resolution : 1280x720
Duration : 00:28:30
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-maya_hills_shane_diesel_SOTD03_clip0116x9.zip - 29.1 MB

Download VIDEO:
UbiqFile:maya_hills_shane_diesel_sheonlytakesdiese l03.mp4 - 1.2 GB

[Uriengit]

Newsensations.com- Kylee Lovit - MILF Date 4





Description:

Mmmm...Kylee Lovit and her bodacious honey chest...nom nom. Kylee set the girls free and our zipper let the love muscle flex and tear into those tits. After hours of her sucking and tit fucking we moved into that dripping wet pussy of hers and dug in ball deep. Our cock was in melon heaven and pink blessings until her juggs were calling, for a gallon load of tit protein man cream.
Model:
Domenic Kane, Kylee Lovit
Studio:
Newsensations.com
Info:
File Name : kylee_lovit_domenic_kane_milfdate04.mp4
File Size : 327.34 MB
Resolution : 1280x720
Duration : 00:27:53
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:um-kylee_lovit_MilfDate04_16x9.zip - 24.1 MB

Download VIDEO:
UbiqFile:kylee_lovit_domenic_kane_milfdate04.mp4 - 327.3 MB

[Uriengit]

Newsensations.com- Kylie G Worthy - MILFs Take Diesel 01





Description:

Kylie Worthy and her massive ta-tas love nothing more than to have Shane Diesel_s huge cock in her mouth or stretching her pussy wide. This MILF knows how to work her muscles around this dick to get everything out of such a gigantic tool. Cum see Kylie Worthy as she gets a poundin_ and gets a special delivery of hot goodness to the face
Model:
Kylie G Worthy, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : kylie_worthy_shane_diesel_milfstakediesel01.mp4
File Size : 1006.18 MB
Resolution : 1280x720
Duration : 00:22:57
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-kylie_worthy_shane_diesel_MILFSTakeDiesel_16x9.zip - 35.6 MB

Download VIDEO:
UbiqFile:kylie_worthy_shane_diesel_milfstakediesel 01.mp4 - 1006.2 MB

[Uriengit]

Newsensations.com- Audrey Bitoni - Ashlynn Friends 02





Description:

Watch this sweet piece of ass sucking and fucking a fat hard cock. Audrey Bitoni loves nothing more then having her pussy stretched wide and pounded by a big hard cock...but a close second is having warm spunk shot on her face
Model:
Audrey Bitoni, Mark Ashley
Studio:
Newsensations.com
Info:
File Name : audrey_ashlynnandfriends-02.mp4
File Size : 278.92 MB
Resolution : 1280x720
Duration : 00:23:49
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 129 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-audrey_bitoni_mark_ashley_AF2_16x9.zip - 8.6 MB

Download VIDEO:
UbiqFile:audrey_ashlynnandfriends-02.mp4 - 278.9 MB

[Uriengit]

Newsensations.com- Brianna Love - What An Ass 05





Description:

Brianna Love has more then an addiction to cock, she is a cock junkie We wag our bone in her face and she gets the hint and starts sucking down our meat. Brianna takes control grabs our pole and crams it deep in her pussy. This babe can ride a damn cock like no other, grinding and squeezing her twat on our cock milking our meat until we blow all over her fine round ass
Model:
Brianna Love, James Deen
Studio:
Newsensations.com
Info:
File Name : brianna_love_james_deen_what-an-ass-05.mp4
File Size : 444.85 MB
Resolution : 1280x720
Duration : 00:38:15
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-brianna_love_james_deen_WhatAnAss05_16x9.zip - 22.3 MB

Download VIDEO:
UbiqFile:brianna_love_james_deen_what-an-ass-05.mp4 - 444.8 MB

[Uriengit]

Newsensations.com- Alexis Texas - Teen Dreams 15





Description:

Alexis Texas is stacked in all the right places. She has amazing natural 36C boobs and hips and ass that you just want to grab a piece of as you are drilling her from behinds. Alexis wraps her lips around our meat and sucks and slobbers and shows every inch of our cock a good time. We give her every hard fucking inch in her tight pretty pussy and fuck the life out of her. We end this fuck fest with a hot load of jizz all over her mouth
Model:
Alexis Texas, Mark Ashley
Studio:
Newsensations.com
Info:
File Name : alexis_texas_mark_ashley_TeenDreams15_853_3k.mp4
File Size : 415.88 MB
Resolution : 852x480
Duration : 00:18:43
Video : AVC (AVC), 2 977 Kbps, 29.970 fps
Audio : AAC (AAC LC), 125 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:jb-alexis_texas_TD15_16x9.zip - 20.2 MB

Download VIDEO:
UbiqFile:alexis_texas_mark_ashley_TeenDreams15_853 _3k.mp4 - 415.9 MB

[Uriengit]

Newsensations.com- Candy Martinez - Big Dick In A Little Chick 01





Description:

Candy Martinez is one tiny little Latina spinner that knows how to stretch her tiny tight little pussy to the max with a big hard cock. Candy loves to get a pussy pounding and milk every last sweet creamy drop from her boy toy. Cum see how Candy gets her sweet tooth fix
Model:
Candy Martinez, Danny Mountain
Studio:
Newsensations.com
Info:
File Name : candy_martinez_danny_mountain_bigdickinalittlechic k01.mp4
File Size : 268.39 MB
Resolution : 1280x720
Duration : 00:22:57
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-candy_martinez_danny_mountain_BigDickInALittleChic k_1920.zip - 5.7 MB

Download VIDEO:
UbiqFile:candy_martinez_danny_mountain_bigdickinal ittlechick01.mp4 - 268.4 MB

[Uriengit]

Newsensations.com- Emma Cummings - It_s Huge 09





Description:

Emma Cummings considers herself a connoisseur of the colossal cock thanks to an elastic mouth and snatch. Her special ability allows her to handle Shane Diesel_s goose neck without passing out and her skills in the bedroom proffer Diesel a shagging he won_t soon forget This big-breasted beauty has a lot to offer a man of unusual size.
Model:
Emma Cummings, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : emma_cummings_shane_diesel_itshuge09.mp4
File Size : 1036.37 MB
Resolution : 1280x720
Duration : 00:23:35
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-emma_cummings_ItsHuge09_16x9.zip - 53.5 MB

Download VIDEO:
UbiqFile:emma_cummings_shane_diesel_itshuge09.mp4 - 1.0 GB